SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016115 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016115
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.11e-27
Family DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain 0.00000772
Further Details:      
 
Domain Number 2 Region: 98-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000157
Family DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016115
Domain Number - Region: 219-266
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 0.054
Family Circadian clock protein KaiA, C-terminal domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016115   Gene: ENSMMUG00000012282   Transcript: ENSMMUT00000017206
Sequence length 292
Comment pep:known chromosome:MMUL_1:15:38527447:38550495:1 gene:ENSMMUG00000012282 transcript:ENSMMUT00000017206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAADGVSPEAAALEQPAELPASVRASVERKRQRALMLRQARLAARPYPATAAAAAGGMA
NVKAAPKIIDTGGGFILEEEEEEEHKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKEVVPAFLNRPQRAEIG
VDTVESRHKELTVQFSQRLRTERNKSKSKSILVEKKLEPGSSWSSDFDPQRS
Download sequence
Identical sequences XP_014972722.1.72884 ENSMMUP00000039522 ENSMMUP00000016115 9544.ENSMMUP00000039522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]