SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016146 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016146
Domain Number 1 Region: 472-631
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-36
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 2 Region: 235-368
Classification Level Classification E-value
Superfamily FAS1 domain 6.67e-34
Family FAS1 domain 0.00062
Further Details:      
 
Domain Number 3 Region: 73-230
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-32
Family FAS1 domain 0.00077
Further Details:      
 
Domain Number 4 Region: 380-496
Classification Level Classification E-value
Superfamily FAS1 domain 5.49e-22
Family FAS1 domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016146   Gene: ENSMMUG00000012307   Transcript: ENSMMUT00000017242
Sequence length 836
Comment pep:known chromosome:MMUL_1:17:16762919:16798110:-1 gene:ENSMMUG00000012307 transcript:ENSMMUT00000017242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPFLPMFSLLLLLVVNHANANSHYDKILTHSRIRGREQGPNVCALQQILGTKKKYFSTC
KNWYKKSICGQKATVLYECCPGYTRMEGMKGCPAVLPIDHVYGTLGIVGATTTQHYSDAS
KLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLK
NGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDF
IEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
MKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHL
IDQVLIPDSAKQVTELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLRM
DQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCVENSCMERGSKQG
RNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDA
FKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVND
TLLVNELKSKESDIMTTNGVIHVVDKLLYPADAPVGNDQLLEILNKLIKYIQIKFVRGST
FKEIPVTVYTTKIITKVVEPKIKVIEGSLQPIIKTEGPTITKVKIEGEPEFRLIKEGETI
TEVIHGEPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGDTEETLKKLF
QEEVTKVTKFIEGGDGHLLEDEEIKRLLQGDTPVRKLQANKKFQGSRRRSREGRSQ
Download sequence
Identical sequences ENSMMUP00000036395 9544.ENSMMUP00000036395 ENSMMUP00000016146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]