SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016169 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016169
Domain Number 1 Region: 463-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-32
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 2 Region: 688-889
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.87e-27
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 911-1113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-25
Family Laminin G-like module 0.0068
Further Details:      
 
Domain Number 4 Region: 224-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000129
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 5 Region: 148-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000347
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 6 Region: 1297-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000102
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 7 Region: 186-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000502
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 8 Region: 304-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000599
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 9 Region: 1141-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 10 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000219
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 11 Region: 1214-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.019
Further Details:      
 
Domain Number 12 Region: 72-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000286
Family EGF-type module 0.025
Further Details:      
 
Domain Number 13 Region: 1176-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 111-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.018
Further Details:      
 
Domain Number 15 Region: 1264-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000005
Family EGF-type module 0.027
Further Details:      
 
Domain Number 16 Region: 339-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000809
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 17 Region: 397-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016169
Domain Number - Region: 885-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00884
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0559
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 924-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0608
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016169   Gene: ENSMMUG00000012322   Transcript: ENSMMUT00000017265
Sequence length 1406
Comment pep:known chromosome:MMUL_1:1:173053621:173260207:-1 gene:ENSMMUG00000012322 transcript:ENSMMUT00000017265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKNINYLLIFYLSFSLLIYIKNSFCNKNNTRCLSNSCQNNSTCKGFSKDNDCSCSGTA
NNVDKDCDNVKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGTCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPLDYSGINCELEIDECWSQPCLNGATCQ
DALGAYFCDCAPGFLGDHCELNIDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCET
LMPLCWSKPCHNNATCEDSVDNYTCHCWPGYTGAQCEIDINECNSNPCQSDGECVELSSE
KQYGHITGLPSTFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTCENLPGNYT
CHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGICIPHFQDGQHGFGCLCPSGYTGSLC
EIATTLSFEGDGFLWVKTGSATTKGSVCNIALRFQTVQPVALLLFRGNRDVFVKLELLSG
YIHLSIQVNSQPKVLLYISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCISKAPSPLE
SDQSICAFQNSFLGGLPVGTTSDGVALLKFYNIPSTPSFVGCLQDIKIDWNHITLENISS
VSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYKGPNCLREFVAGRFGQND
STGYVVFTLDESYGDTVSLSMFVQTLQPSGLLLALENSTYQYIRVWLEHGRLAMLTPNSP
KLVVKFVLNDGNVHLISLKIKPNKIELYQSSQNLGFISASTWKIQKGDVIYIGGLPDKQE
TELNGGFFKGCIQDVRLNNQNLEFFPNSTNNVSLKPVLVNVTQGCPGDNSCKSNPCRNGG
VCHSLWDDFSCSCPAHMSGKACEEVQWCGFSPCPHEAQCQPVLQGFECIANAVFNEQSSQ
ILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQSGNSFYT
LSLTSLQSVNDGMWHEVTLSMTDPMSQTSRWQMEVDNQTPFVTSTIATGSLNFLKDNTDI
YVGDGAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFTNKPQEEQFLKISTNSVVTGCLQL
SVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNTDECFSNPCIHGNCSDRVAAYHC
TCEPGYTGGNCEVDIDNCQSHQCANGATCISDTNGYSCLCFGNFTGKFCRQSRLPSTVCG
NEETNLTCYNGGNCTEFQAELKCMCRPGFTGERCEKDIDECASDPCVNGGLCQDLLNKFQ
CLCDVAFAGERCEVDLADDLISDIFTAIGSVTLALLLILLLAIVASVVTSNKRATQGTYS
PSRQEKEGSRVEMWNLMPPPAMERLI
Download sequence
Identical sequences ENSMMUP00000016170 9544.ENSMMUP00000016170 ENSMMUP00000016169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]