SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016181 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016181
Domain Number 1 Region: 432-659
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000000000259
Family Exostosin 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016181   Gene: ENSMMUG00000012329   Transcript: ENSMMUT00000017277
Sequence length 675
Comment pep:known chromosome:MMUL_1:1:28635843:28649162:1 gene:ENSMMUG00000012329 transcript:ENSMMUT00000017277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWRRRKSLWLALSASWLLLVLLGGFSLLRLALPPRPRPGAPQGWPRWLDAELLQSFSQ
AGELPEDAASPQAPHGGSCNWGACFDTSKCRGDGLKVFVYPASGPISETHHRILASIEGS
RFHTFSPAGACLLLLLSLDAQTGECSSMPLQWNRGRNHLVLRLHPAPCPKTFQLGQAMVA
EASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLQQHSPQPGIALLALEEERGGWRTADT
GSSACPWDARCEQDPGPGQTQRGETLPNATFCLISGHRPEAASRFLQALQAGCIPVLLSP
RWELPFSEVIDWTKAAIVADERLPLQVLAALQEMSPARVLALRQQTQFLWDAYFSSVEKV
IHTTLEVIQDRIFGTSAHPSLLWNSPPGALLALSTFSTSPQDFPFYHLQQGSRPEGRFSA
LIWVGPPGQPPLKLIQAVAGSQHCAQILVLWSNERPLPSSWPETAMPLTVIDGHRKVSDR
FFPYSTIRTDAILSLDARSSLSTSEVDFAFVVWQSFPERMVGFLTSSHFWDEAHGGWGYT
AERTNEFSMVLTTAAFYHRYYHTLFTHSLPKALRTLADEAPTCVDVLMNFLVAAVTKRPP
IKVPYGKQRQEAAPLASGGPGPRPKPQAPAPNCVNQIAAAFGHMPLLSSRLRLDPVLFKD
PVSVQRKKYRSLEKP
Download sequence
Identical sequences XP_001108035.2.72884 ENSMMUP00000016181 ENSMMUP00000016181 9544.ENSMMUP00000016181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]