SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016188 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016188
Domain Number 1 Region: 259-461
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.44e-49
Family Reprolysin-like 0.0019
Further Details:      
 
Domain Number 2 Region: 555-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000118
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 974-1024
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000824
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 913-971
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000118
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 5 Region: 851-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000051
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016188   Gene: ENSMMUG00000012330   Transcript: ENSMMUT00000017284
Sequence length 1226
Comment pep:known chromosome:MMUL_1:9:66252693:66339606:-1 gene:ENSMMUG00000012330 transcript:ENSMMUT00000017284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLRALLSCLLPLHCALCAAAGSRTPELHLSGKLSDYGVTVPCSTDFRGRFLSHVVSGP
AAASAESMVVDTPPTLPRHSSHLRVARSPLHPGGTLWHGRAGRHSLYFNVTVFGKELHLR
LWPNRRLIVPGASVEWQEDFRELFRQPLRQECVYTGGVTGMPGAAVAISNCDGLAGLIRT
DSTDFFIEPLERGQQEKEASGRTHVVYRREAVQQEWAEPHGDLHNEAFGLGDLPNLLGLV
GDQLGDTERKRRHAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESL
GVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPGHAEHHDHVVFLT
RQDFGPSGMQGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCAD
ETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGIDYS
MDEQCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFK
GHCIWKSPEQTYGQDGGWSSWTKFGSCSRSCGGGVRSRSRSCNNPPLAYGGRPCLGPMFE
YQVCNSEECPGPYEDFRAQQCAKRNSYYVHQNTKHSWVPYEPDDDTQKCELICQSADTGD
VVFMNQVVHDGTRCSYRDPYSVCARGECVPVGCDKEVGSMKADDKCGVCGGDNSHCRTVK
GTLGKASKQAGALKLVQIPAGARHIQIEALEKSPHRIVVKNQVTGSFILNPKGKEATSRT
FTAMGLEWEAAVEDAKESLKTSGPLPEAIAILVLPPTEGGPRSSLAYKYIIHEDLLPLIG
SNNVLLEETDTYEWALKSWAPCSKACGGGIQFTKYGCRRRRDHHMVQRHLCDHKKRPKPI
RRRCNQHLCSQPAWVMEEWGACSRSCGKLGVQTRGIQCLLPLSNGTHKVMPAKACAGDRP
EARRPCLRVPCPAQWRLGAWSQCSATCGEGIQQRQVVCRTNANSLGQCEGDRPDTVQVCS
LPACGGNRQNSTVRADVWERGTPEGQWVPQSGPLHPINKISSTEPCTGDRSVFCQMEVLD
RYCSIPGYHRLCCVSCIKKASGPNPSPDPGPTSLPPSSTPGSLLPGPQAPPDAVEPPGKP
TGSEDHQHGGATQLPGALDTRSPGTKRPFAPETLISGASWSISPTTPGGLPWGWTQTPMP
VPEDKGQPGEDLRHPGTSLPAASPVT
Download sequence
Identical sequences 9544.ENSMMUP00000016188 XP_015002937.1.72884 ENSMMUP00000016188 ENSMMUP00000016188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]