SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016191 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016191
Domain Number 1 Region: 284-345
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000778
Family UBA domain 0.0097
Further Details:      
 
Domain Number 2 Region: 14-193
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000000000106
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016191   Gene: ENSMMUG00000012332   Transcript: ENSMMUT00000017287
Sequence length 345
Comment pep:known chromosome:MMUL_1:17:79573876:79760468:1 gene:ENSMMUG00000012332 transcript:ENSMMUT00000017287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTSTGSSGLYKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQIWRLICG
RIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLVEAMQYFFGI
TAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIW
IVAISGLMSGLCYNSKMFQVHQVLCIPSWMAKFFSWTLEPIFSSSEPTSEARIGMGATLD
IQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINWNRLFPPLRQRQNVNYQGGRQSEPAA
PPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences A0A096MQI4 A0A2K5KI98 A0A2K6D9P6 F7FHG0 Q4R910
ENSMMUP00000016191 ENSPANP00000002012 ENSMMUP00000016192 9544.ENSMMUP00000016192 NP_001164647.1.72884 NP_001270306.1.63531 XP_011732933.1.29376 XP_011890803.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]