SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016239 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016239
Domain Number 1 Region: 2-357
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.22e-122
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016239   Gene: ENSMMUG00000015034   Transcript: ENSMMUT00000017339
Sequence length 358
Comment pep:known chromosome:MMUL_1:9:22764163:22805578:-1 gene:ENSMMUG00000015034 transcript:ENSMMUT00000017339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INELSHVQIPVMLMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGID
DQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILKKYHQYIVE
CHGITLLPQFLGMYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAK
ELPTLKDNDFINEGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQ
EEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSP
RKEVYFMAIIDILTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT
Download sequence
Identical sequences A0A2K5JCB7 G7PEL6
ENSMMUP00000016239 ENSPTRP00000003988 ENSMMUP00000019705 9544.ENSMMUP00000019705 9598.ENSPTRP00000003988 9615.ENSCAFP00000006237 ENSPTRP00000003988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]