SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016268 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016268
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.48e-20
Family Thyroglobulin type-1 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016268   Gene: ENSMMUG00000012390   Transcript: ENSMMUT00000017372
Sequence length 289
Comment pep:known chromosome:MMUL_1:13:47493885:47508678:1 gene:ENSMMUG00000012390 transcript:ENSMMUT00000017372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECVCENYKLAVNCFLNDNGQCQCTSIGAQNTVLCSKLAAKCLVMKAEMNGSKLGRRAKPE
GALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWII
IELKHKAREKPYDVQSLRTALEEAIKTRYQLDPKFITNILYEDNVITIDLVQNSSQKTQN
DVDIADVAYYFEKDVKGESLFHSKKMDLRVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
AGVIAVIVVVVIAIVAGIVVLVISRKKRMAKYEKAEIKEMGEIHRELNA
Download sequence
Identical sequences G7PM59
ENSMMUP00000016268 9544.ENSMMUP00000016268 ENSMMUP00000016268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]