SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016350 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016350
Domain Number 1 Region: 255-564
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-116
Family Transglutaminase core 0.0000000184
Further Details:      
 
Domain Number 2 Region: 83-254
Classification Level Classification E-value
Superfamily E set domains 3.36e-45
Family Transglutaminase N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 578-689
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.89e-30
Family Transglutaminase, two C-terminal domains 0.00049
Further Details:      
 
Domain Number 4 Region: 690-789
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-29
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016350   Gene: ENSMMUG00000012452   Transcript: ENSMMUT00000017459
Sequence length 818
Comment pep:known chromosome:MMUL_1:7:87143978:87158432:-1 gene:ENSMMUG00000012452 transcript:ENSMMUT00000017459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDRRFRRGGGGRSFWARCCGCCSCRNVADD
DWGPEPSDSRGRGSSSGTRRPGSRGSDSRQPVSRGSGVNAAGDGTIREGMLVVTGVDLLS
SRSDQNRQEHHTDEYEYDELIVRRGQPFRMLLLLSRTYESSDRITLELLIGNNPEVGKGT
HVIIPVGKGGSGGWKAQVTKASGQTLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDA
RNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLD
ACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSV
EILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDE
NMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVES
IKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMRED
ITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVM
LTNHSSSRRTVKLHLYLSVTFYTGVTGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHL
VDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPV
TLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVH
GVIQVDVAPAPGDRGFFSDAGGDSHLGETIPMASRGGA
Download sequence
Identical sequences ENSMMUP00000016350 ENSMMUP00000016350 9544.ENSMMUP00000016350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]