SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016376 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016376
Domain Number 1 Region: 44-413
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.57e-122
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016376   Gene: ENSMMUG00000012472   Transcript: ENSMMUT00000017486
Sequence length 519
Comment pep:known chromosome:MMUL_1:15:77619097:77740498:1 gene:ENSMMUG00000012472 transcript:ENSMMUT00000017486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQVKNQILSRLPKIPCTFIQAWTNTEMITLLACYYFRSVSVTASSAIKGAIQLGIGYTVG
NLTSKPERDVLMQDFYVVESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKP
DDYLYSICSEPLIELSNPGASGSLFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQN
PRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRSMRMHFTYDLKGSTYKRRASRKEREKSN
PTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKE
KEEETSQNVPDAKRPGMQKVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRGEKL
LLFMGIIDILQSYRLMKKLEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQAL
KASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQSFSSLDEEALGSRHRPDL
VPSTPSLFEAASLATTISSSSLYVNEHYPHDRPTLYSNR
Download sequence
Identical sequences ENSMMUP00000016376 9544.ENSMMUP00000016376 ENSMMUP00000016376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]