SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016476 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016476
Domain Number 1 Region: 17-146
Classification Level Classification E-value
Superfamily Gamma-glutamyl cyclotransferase-like 3.53e-17
Family Gamma-glutamyl cyclotransferase-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016476   Gene: ENSMMUG00000012550   Transcript: ENSMMUT00000017594
Sequence length 188
Comment pep:known chromosome:MMUL_1:3:95714464:95722640:1 gene:ENSMMUG00000012550 transcript:ENSMMUT00000017594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSGCKDVPGPDEESFLYFAYGSNLLTERIHLRNPSAAFFCVARLQDFKLDFGNSQGKT
SQTWHGGIATIFQSPGDEVWGVVWKMNKSNLNSLDEQEGVKSGMYVVIEVKVATQEGREI
TCRSYLMTNYESAPPSPQYKKIICMGAKENGLPLEYQEKLKAIEPNDYTGKVAEEIEDII
KKGETQTL
Download sequence
Identical sequences A0A096N0Y3 A0A2K5L598 A0A2K5YEB5 A0A2K6BH07 F7E821 G7P0H3
NP_001253898.1.72884 XP_005549937.1.63531 XP_011729628.1.29376 XP_011827598.1.47321 XP_011938265.1.92194 9544.ENSMMUP00000016476 ENSPANP00000005923 ENSMMUP00000016476 ENSMMUP00000016476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]