SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016504 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016504
Domain Number 1 Region: 13-152
Classification Level Classification E-value
Superfamily PX domain 0.000000000000997
Family PX domain 0.01
Further Details:      
 
Domain Number 2 Region: 183-382
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000016
Family BAR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016504   Gene: ENSMMUG00000012576   Transcript: ENSMMUT00000017624
Sequence length 386
Comment pep:known chromosome:MMUL_1:7:97509941:97563029:-1 gene:ENSMMUG00000012576 transcript:ENSMMUT00000017624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHD
SFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFK
KTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDVSIKLIGGQVFFLFFGMILTHRKLRL
SVKKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALGTQDS
TDICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYLRESQAAKDLLYRRSRSLVDY
ENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQELIDFKTRRVAAFRKNLVEL
AELELKHAKGNLQLLQNCLAVLNGDT
Download sequence
Identical sequences ENSMMUP00000016504 ENSMMUP00000016504 9544.ENSMMUP00000016504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]