SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016516 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016516
Domain Number 1 Region: 68-135
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 226-270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000118
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016516
Domain Number - Region: 132-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.000115
Family VWC domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016516   Gene: ENSMMUG00000012582   Transcript: ENSMMUT00000017636
Sequence length 372
Comment pep:known chromosome:MMUL_1:4:151872202:151889244:-1 gene:ENSMMUG00000012582 transcript:ENSMMUT00000017636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKRRLLYPSGWLHGPSDMRGLLFSTLLLADLAQFCCRAQGTGPLDTTPEGRPGEVSDAH
QRKQFCHWPCKCPHQKPHCPPGVSLVRDGCGCCKICAKQPGEICNEADLCDPHKGLYCDY
SVDRPRYETGVCAYLVAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAIGCTPLFIPKLAD
GHCSGAKGGKKSDQSNCGLEPLLQQLSTSYKTMPAYRNLPLIWKKKCLVQATKWTPCSRT
CGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNILKTIKIPKGKTCQPIFQLSKAEKFVF
SGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWITSCVCQRNCR
EPGDIFSELKIL
Download sequence
Identical sequences F7FEB2
ENSMMUP00000016516 ENSMMUP00000016516 XP_001083520.1.72884 9544.ENSMMUP00000016516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]