SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016559 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016559
Domain Number 1 Region: 626-811
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-30
Family Fibronectin type III 0.00000692
Further Details:      
 
Domain Number 2 Region: 288-389
Classification Level Classification E-value
Superfamily Immunoglobulin 7.2e-24
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 496-600
Classification Level Classification E-value
Superfamily Fibronectin type III 1.17e-23
Family Fibronectin type III 0.000000955
Further Details:      
 
Domain Number 4 Region: 201-297
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-23
Family I set domains 0.0052
Further Details:      
 
Domain Number 5 Region: 397-487
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 6 Region: 115-209
Classification Level Classification E-value
Superfamily Immunoglobulin 5.06e-22
Family I set domains 0.026
Further Details:      
 
Domain Number 7 Region: 9-109
Classification Level Classification E-value
Superfamily Immunoglobulin 5.87e-21
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016559   Gene: ENSMMUG00000012609   Transcript: ENSMMUT00000017683
Sequence length 1358
Comment pep:known chromosome:MMUL_1:2:1573170:2108711:1 gene:ENSMMUG00000012609 transcript:ENSMMUT00000017683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTPTIEWYKDGERVETDKDDPRS
HRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAVSRNASLEVALLRDDFRQNPT
DVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEERISIRGGKLMISNTRKSDAGM
YTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEEAVEFRCQVQGDPQPTVRWKK
DDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGKMEASATLTVRAPPQFVVRP
RDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQPQQPNSRCSVSPTGDLTITN
IQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPIILQGPANQTLAVDGTALLKCK
ATGDPLPVISWLKEGFTFLSRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWS
AVLDVTESGATISKNYDLNDLPGPPSKPQVTDVTKNSVTLSWQPGTPGTLPASAYIIEAF
SQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINPQGLSDPSPMSDPVRTQDISP
PAQGVDHRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDRQPQFIQGYRVMYRQTSGLQA
TSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTEEAPSAPP
QSVTVLTVGSYNSTSISVSWDPPPPDHQNGILQEYKIWCLGNETRFHINKTVDAAIRSVI
IGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVVITENNNSITEQITDVVKQPA
FIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRGDGGLMTNGSRPGLLNAGDPS
YPWLADSWPATSLPVNNSNSGPNDIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFT
TKTTYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQ
NKGNNGGKGGKKKKNKNSSKPQKNNGSTWANVPLPPPPVQPLPGTELEHYAAEQQENGYD
SDSWCPPLPVQTYLHQGLEDELEEDDDRVPTPPVRGVASSPAISFGQQSTATLTPSPREE
MQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPPLGYVSGALISDLETDVPDDD
ADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSSQRPRPTSPFSTDSNTSAAVS
QSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSKPSFPSPGGHSSSGTASSKGS
TGPRKAEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL
Download sequence
Identical sequences ENSMMUP00000016559 9544.ENSMMUP00000016559 ENSMMUP00000016559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]