SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016603 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016603
Domain Number 1 Region: 630-920
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-78
Family Protein kinases, catalytic subunit 0.0000000437
Further Details:      
 
Domain Number 2 Region: 27-202
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.08e-55
Family Ephrin receptor ligand binding domain 0.0000157
Further Details:      
 
Domain Number 3 Region: 334-539
Classification Level Classification E-value
Superfamily Fibronectin type III 1.06e-24
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 4 Region: 910-977
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.69e-20
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Domain Number 5 Region: 263-336,372-394
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000173
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016603   Gene: ENSMMUG00000012638   Transcript: ENSMMUT00000017729
Sequence length 978
Comment pep:known chromosome:MMUL_1:3:180942208:180959343:-1 gene:ENSMMUG00000012638 transcript:ENSMMUT00000017729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRWPLGLGLVLLLCTPLPPGARTKEVTLMDTSKAQGELGWLLDPPKDGWSERQQILNG
TPLYMYQDCPVQGRRDTDHWLRSNWIYRGEEASRVHVELQFTLRDCKSFPGGAGPLGCKE
TFNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLASGSMKLNVERCSLGHLTRRG
LYLAFHNPGACVALVSVRVFYQRCPETLNGLAQFPDTLPGPAGLVEVAGTCLPHAQASPS
PRPSGAPRMHCSPDGEWLVPVGRCHCEPGYEEGGSGKGCVACPSGSYRMDMDTPHCLTCP
QHSTAESEGATICTCESGHYRAPGEGPQVACTRPPSAPQNLSSSASGTQLSLRWEPPADM
GGRQDVRYSVRCSQCQGTVQDGGPCQPCGVGVHFSPGARGLTTSAVHVSGLEPYANYTFN
VEAQNGVSGLGSSGHASTSVSISMGHAEPLSGLSLRLVKKEPRQLELTWAGSRPRSPGGN
LSYELHVLNQDEERYQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPP
VSRGLSGGEIIAVIFGLLLGAALLLGILVFRSRRAQRQRQQRQRDRATDVDREDKLWLKP
YVDLQAYEDPAQGALDFTRELDPAWLMGDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTL
KDTSPGGQWWNFLREATIMGQFSHPHILHLEGVITKRKPIMIITEFMENGALDAFLREQE
DQLVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQDLCCKVSDFGLTRLLDDFD
GTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKS
IEDGYRLPPPVDCPAPLYELMKNCWAYDRARRPHFQKLQAHLEQVLANPHSLRTIANFDP
RVTLRLPSLSGSDGIPYRSVSEWLESIRMKRYILHFHSAGLDTMECVLELTAEDLTQMGI
TLPGHQKRILCSIQGFKD
Download sequence
Identical sequences 9544.ENSMMUP00000016603 ENSMMUP00000016603 ENSMMUP00000016603 XP_001090564.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]