SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016668 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016668
Domain Number 1 Region: 39-86
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000017
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 475-539
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000327
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 205-258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000484
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 876-923
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 616-670
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 542-611
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number 7 Region: 1249-1313
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 8 Region: 934-1004
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000955
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 9 Region: 1010-1060
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000144
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 266-340
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000589
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number 11 Region: 747-802
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000746
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016668
Domain Number - Region: 353-418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000837
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number - Region: 1063-1111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00131
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number - Region: 811-875
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0244
Family TSP-1 type 1 repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016668   Gene: ENSMMUG00000012694   Transcript: ENSMMUT00000017798
Sequence length 1496
Comment pep:known chromosome:MMUL_1:3:114631343:114918309:1 gene:ENSMMUG00000012694 transcript:ENSMMUT00000017798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REIVCIQKDKDIPAEDTICEYFEPKPLLEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQ
HRTRHVVAPPQFGGSGCPNLTEFQVCQSSPCEAEELMYSLHVGPWSTCSMPHSRQVRQAR
RRGKNKEREKDRSKGVKDPEARELIKKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTG
KAADLSFCQQEKLPMTFQSCVITKECQVSEWSEWSPCSKTCHDMVSPAGTRVRTRTIRQF
PIGSEKECPELEEKEPCLSQGDGVAPCAMYGWRTTEWTECRVDPLLSQQDKRRGNQTALC
GGGIQTREVYCVQANENLLSQLNTHKNKEASKPVDLKLCTGPIPNTTQLCHIPCPTECEV
SPWSAWGPCTYENCNDQQGKKGFKLRKRRITNEPTGGSGGTGNCPHLLEAIPCEEPACYD
WKAVRLGDCEPDNGKECGPGTQVQEVVCINSDGEEVDRQLCRDAIFPIPVACDAPCPKDC
VLSTWSTWSSCSHTCSGKTTEGKQIRARSILAYAGEEGGIRCPNSSALQEVRSCNEHPCT
VYHWQTGPWGQCIEDTSVSSFNTTTTWNGEASCSVGMQTRKVICVRVNVGQVGPKKCPES
LRPETVRPCLLPCKKDCIVTPYSDWTSCPSSCKEGDSSIRKQSRHRVIIQLPANGGRDCT
EPLYEEKTCDTPQVCQSYRWKTHKWRRCQLVPWSVQQDSPGAQEGCGPGRQARAITCRKQ
DGGQAEIHECLQYAGPVPALTQACQIPCQDDCQLTSWSKFSSCNGDCGAVRTRKRTLVGK
SKKKEKCKNSHLYPLIETQYCPCDKYNAQPVGNWSDCILPEGKVEVLLGMKVQGDIKECG
QGYRYQAMACYDQNGRLVETSRCNSHGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGV
KVRSKWLREKPYNGGRPCPKLDHVNQSHVYEVVPCHSDCNQYLWVTEPWSICKVTFVNMR
ENCGEGVQTRKVRCMQNTADGPSEHVEDYLCDPEEMPLGSRVCKLPCPEDCVISEWGPWT
RCVLPCNQSSFRQRSADPIRQPADEGRSCPNAVEKEPCNLNKNCYHYDYNVTDWSTCQLS
EKAVCGNGIKTRMLDCVRSDGKSVDLKYCEEVDGCCVISSRVNSSLIISVHAEPSDPNAW
GTISKVNKSTRKQIVQLPYRASRVSNASLNVHKSNSLMKYFSFSNELFLPPFQEAQCGEG
TRTRNISCIVSDGSADDFSKVVDEEFCADIELIIDGNKNMVLEETCTEPCPGDCYLKDWS
SWSLCQLTCVNGEDLGFGGIQVRSRAVIIQELENQHLCPEQMLETKSCDDGHCYEYKWMA
SAWKGSSRTVWCQRSDGINVTGGCLVMSQPDADRSCNPPCSQPHSYCSETKTCHCEEGYT
EVMSSNSTLEQCTLIPVVVIPTVEDKRGDVKTSRAVHPTQPSSNPAGRGRTWFLQPFGPD
GRLKTWVYGVAAGAFVLLIFIVSMIYLACKKPKKPQRRQNNRLKPLTLAYDGDADM
Download sequence
Identical sequences ENSMMUP00000016668 ENSMMUP00000016668 9544.ENSMMUP00000016668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]