SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016697 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016697
Domain Number 1 Region: 429-660
Classification Level Classification E-value
Superfamily GFP-like 4.5e-91
Family Domain G2 of nidogen-1 0.00000000146
Further Details:      
 
Domain Number 2 Region: 943-1179
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-46
Family YWTD domain 0.000000000746
Further Details:      
 
Domain Number 3 Region: 811-919
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.01e-25
Family Thyroglobulin type-1 domain 0.00053
Further Details:      
 
Domain Number 4 Region: 761-841,877-890,1200-1244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.43e-18
Family Growth factor receptor domain 0.0087
Further Details:      
 
Domain Number 5 Region: 385-426,671-769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-16
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016697   Gene: ENSMMUG00000012716   Transcript: ENSMMUT00000017831
Sequence length 1247
Comment pep:known chromosome:MMUL_1:1:220951549:221046755:1 gene:ENSMMUG00000012716 transcript:ENSMMUT00000017831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASSSRIRAAWTRALLLPLLLAGPGGCLSRQELFPFGPGQGDLELEDGDDLVSPALELS
GALRFYDRSDIDSVYVTTNGIIATSEPPAKESHPGLFPPTFGAIGPFLADLDTTDGLGKV
YYREDLSPSITQRAAECVHRGFPEISFQPSSAVVVTWESVAPYQGPSREPEQEGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFHTTFSKKENNQVPAMVAFSQGSVGFLWKSNGAFNIFA
NDRESIENLAKSSNSGQQGVWVFEIGSPATTNGVVPADVILGTEEGAEYDDEDEDYDLVT
TRLGLEDVGTTPFSYKALRRGGADTYSVPSVLSPHRAATERPLGPPTERTRSFQLAVETF
HQQHPQVIDVDEVEETGVVFSYNTDSRQTCANNRHQCSVHAECRDYATGFCCSCVAGYTG
NGRQCVAEGQPYRVNGKVKGRIFVGSSQIPIVFENTDLHSYVVMNHGRSYTAISTIPETV
GYSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFIGHPGKLVIKQRFSGI
DEHGHLTIDTELEGHVPQIPFGSSVHIEPYTELYHYSTSVITSSSTREYTVTEPEREGAA
PSRVYTYQWRQTITFQECVHDDSRPALPSTQQLSVDSVFVLYNQEERILRYALSNSIGPV
REGSPDALQNPCYIGTHGCDTNAACRPGPRTQFTCECSIGFRGDGRTCYDIDECSEQPSV
CGSHAVCNNHPGTFRCECVEGYQFSDEGTCVAVVDQRPINYCATGLHNCDIPQRARCIYT
GGSSYTCSCLPGFSGDGQACQDVDECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCV
PGEVEKTRCQHEREHILGAAGAADPQRPIPPGLFVPECDAHGHYAPTQCHGSTGYCWCVD
RDGREVEGTRTRPGMTPPCLSTVAPPIHQGPAVPTAVIPLPPGTHLLFAQTGKIERLPLE
GNTMRKTEAKAFLHVPAKVIIGLAFDCVDKMVYWTDITEPSIGRASLHGGEPTTIVRQDL
GSPEGIAVDHLGRNIFWTDSNLDRIEVAKLDGTQRRVLFETDLVNPRGIVTDSVRGNLYW
TDWNRDNPKIETSYMDGTNRRILVQDDLGLPNGLTFDAFSSQLCWVDAGTNRAECLNPSQ
PSRRKVLEGLQYPFAVTSYGKNLYYTDWKMNSVLALDLAISKETDAFQPHKQTRLYGITT
ALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
Download sequence
Identical sequences ENSMMUP00000016697 9544.ENSMMUP00000016697 ENSMMUP00000016697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]