SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016721 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016721
Domain Number 1 Region: 108-355
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-40
Family Kelch motif 0.023
Further Details:      
 
Domain Number 2 Region: 46-83
Classification Level Classification E-value
Superfamily F-box domain 0.000000000183
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016721   Gene: ENSMMUG00000012733   Transcript: ENSMMUT00000017856
Sequence length 716
Comment pep:known chromosome:MMUL_1:1:19054216:19148858:-1 gene:ENSMMUG00000012733 transcript:ENSMMUT00000017856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSDSEDDSFMAVDQEETVLEGTMEQDEEPHPVLEADETRHNRSMSELPEEVLEYILS
FLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRF
SHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLV
VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVI
DDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILG
GCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQCVVVFSQAPSG
RAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP
SGSREGSLSPARGDGSPILNGGSLSPGTAAVGGSSLDSPVQAISPSTPSAAEGYDLKMGL
SLAPRRGSLPDQKDLRLGSIDLNWDLKSASSSNPMDGMDNRTVGSMRHPPEQTNGVHTPP
HVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPI
PRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVK
WKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Download sequence
Identical sequences F7ETH8 G7NU98
ENSMMUP00000016721 NP_001253335.1.72884 9544.ENSMMUP00000016721 ENSMMUP00000016721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]