SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016789 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000016789
Domain Number - Region: 222-283
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0432
Family SNARE fusion complex 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016789   Gene: ENSMMUG00000012780   Transcript: ENSMMUT00000017928
Sequence length 291
Comment pep:known chromosome:MMUL_1:2:72555938:72582863:-1 gene:ENSMMUG00000012780 transcript:ENSMMUT00000017928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPQLYLPEPFKIAYGKVGQCRRFQQLKKKNGSFKRKGIERWHRAVSTNLLKQNVLVPK
EESSSDSDMGFHESQQNQKRNLMTKVKTAFGRMLSYKCRSKLASASKEGSTDHKEALLSN
MQSLLPRIVKELPSPKLFTAKMRKLSENATIQLDVVEAETEEITQGNTLLRARRTTKRLS
VTSLPSGLQKGPYSPKKRPHFPALKKKHGMKNILRKSDLTVGKLQMQVDDLIETVTDKSM
KLLAQRHAELQRCEFLGDEILQSSKQFQRISKRTMRKYKFKNMTTKGPGDS
Download sequence
Identical sequences F7EID1
9544.ENSMMUP00000016789 ENSMMUP00000016789 ENSMMUP00000016789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]