SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016792 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000016792
Domain Number - Region: 42-170
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.046
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016792   Gene: ENSMMUG00000012783   Transcript: ENSMMUT00000017931
Sequence length 198
Comment pep:known chromosome:MMUL_1:2:72561412:72567367:1 gene:ENSMMUG00000012783 transcript:ENSMMUT00000017931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGK
TLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVI
QHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEK
LSEVEDAQEASMETDPKP
Download sequence
Identical sequences 9544.ENSMMUP00000016792 ENSMMUP00000016792 ENSMMUP00000016792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]