SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016860 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016860
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-24
Family Ubiquitin-related 0.00000524
Further Details:      
 
Domain Number 2 Region: 569-620
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000924
Family UBA domain 0.0014
Further Details:      
 
Domain Number 3 Region: 202-254
Classification Level Classification E-value
Superfamily ARM repeat 0.00000691
Family Mo25 protein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016860   Gene: ENSMMUG00000012836   Transcript: ENSMMUT00000018007
Sequence length 624
Comment pep:known chromosome:MMUL_1:X:55011369:55014630:1 gene:ENSMMUG00000012836 transcript:ENSMMUT00000018007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENGESSGPPRPSRGPAAAQGSAAAQAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAG
TNATSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPE
MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARN
PAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS
SGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYV
ASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGV
GVGVLGTAIGPVGPVTPLGPIGPIVPFTPIGPIGPIGPTGPAGPPGSTGSGGPTGPTVSS
AAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREAN
LQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences A0A2K5NTM0 A0A2K6CXP7 F6TBT9 G8F2K6
9544.ENSMMUP00000016860 ENSMMUP00000016860 ENSMMUP00000016860 XP_011712813.1.29376 XP_011884753.1.92194 XP_014983041.1.72884 XP_015299111.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]