SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016956 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016956
Domain Number 1 Region: 115-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.93e-48
Family Hypothetical protein AT3g04780/F7O18 27 0.0000555
Further Details:      
 
Domain Number 2 Region: 4-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.46e-22
Family Thioltransferase 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016956   Gene: ENSMMUG00000012915   Transcript: ENSMMUT00000018111
Sequence length 289
Comment pep:known chromosome:MMUL_1:18:49862639:49913952:-1 gene:ENSMMUG00000012915 transcript:ENSMMUT00000018111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVD
VHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSGEDTDIP
KGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSM
KFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH
Download sequence
Identical sequences A0A2K5IQL5 A0A2K5LVZ9 A0A2K5VYV7 A0A2K5YKP5 A0A2K6B6F5 A0A2K6P679 I0FIJ3
ENSMMUP00000016956 9544.ENSMMUP00000016956 NP_001248637.1.72884 XP_005586667.1.63531 XP_010362571.1.97406 XP_011731740.1.29376 XP_011804605.1.43180 XP_011827107.1.47321 XP_011924374.1.92194 ENSMMUP00000016956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]