SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016967 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016967
Domain Number 1 Region: 5-191
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.07e-52
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.0000000144
Further Details:      
 
Domain Number 2 Region: 203-277
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000000523
Family Blood coagulation inhibitor (disintegrin) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016967   Gene: ENSMMUG00000012921   Transcript: ENSMMUT00000018123
Sequence length 546
Comment pep:known chromosome:MMUL_1:13:9584183:9614783:-1 gene:ENSMMUG00000012921 transcript:ENSMMUT00000018123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQ
DFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADL
VTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSNCSKQSIYKT
IESKAQECFQERSNKVCGNSRVDEGEECDPGIMYLNNDTCCNSDCTLKEGVQCSDRNSPC
CKNCQFETAQKKCQEAINATCKGVSYCTGNSSECPPPGNAEDDTVCLDLGKCKDGKCIPF
CEREQQLESCACNETDNSCKVCCRDLSGRCVPYVDAEQKNLFLRKGKPCTVGFCDMNGKC
EKRVQDVIERFWDFIDQLSINTFGKFLADNIVGSVLVFSLIFWIPFSILVHCVSKASDRR
EGHGLFLAIEYIDGIQTGSLVLDRGPCPLLPIMLQPQCGPGVSSIWDICHVMHRKMPLLF
PCPQRDKFLRKHSTETLPLFVLNAKISSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVD
SKETEC
Download sequence
Identical sequences 9544.ENSMMUP00000016967 ENSMMUP00000016967 ENSMMUP00000016967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]