SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017007 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017007
Domain Number 1 Region: 4-68
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 3.4e-20
Family Surp module (SWAP domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 191-284
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.000000131
Family RPR domain (SMART 00582 ) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017007   Gene: ENSMMUG00000012958   Transcript: ENSMMUT00000018168
Sequence length 916
Comment pep:known chromosome:MMUL_1:19:16064486:16089944:-1 gene:ENSMMUG00000012958 transcript:ENSMMUT00000018168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMPLPPDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKL
ALEQQQLICKQQTPELEPAAAMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQE
QHLLALRQEQVTAAVPHAVEQQMQKLLEETQLDMNEFDNLLQPIIDTCTKDAISAGKNWM
FSNAKSPPHCELMAGHLRNRITADGAHFELRLHLIYLINDVLHHCQRKQARELLAALQKV
VVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQLQSPALGLGQYQATLINEYS
SVVQPVQLAFQQQIQTLKTQHEEFVTSLAQQQQQQQQQQQQLQMPQMEAEVKATPPPPAP
PPAPAPAPAIPPTTQPDDSKPPIQMPGSSEYEAPGGVQDPAAAGPRGPGPHDQIPPNKPP
WFDQPHPVAPWGQQQPPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPGWNGQRDAPW
NNQPDPAWNSQFEGPWNSQHEQPPWGGGQREPPFRMQRPPHFRGPFPPHQQHPQFNQPPH
PHNFNRFPPRFMQDDFPPRHPFERPPYPHRFDYPQGDFPAEMGPPHHHPGHRMPHPGINE
HPPWAGPQHPDFGPPPHGFNGQPPHMRRQGPPHINHDDPSLVPNVPYFDLPAGLMAPLVK
LEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHDRPRNSEGWEQNGLYEFFRAK
MRARRRKGQEKRNSGPSRSRSRSKSRGRSSSRSNSRSSKSSGSYSRSRSRSCSRSYSRSR
SRSRSRSRSSRSRSRSQSRSRSKSYSPGRRRRSRSRSPTPPSSAGLGSNSAPPIPDSRLG
EENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRN
KSYSFIARMKARDECK
Download sequence
Identical sequences ENSMMUP00000017007 ENSMMUP00000017007 9544.ENSMMUP00000017007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]