SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017013 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017013
Domain Number 1 Region: 497-769
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.17e-64
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 63-136
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 3.79e-22
Family Mib/herc2 domain 0.00077
Further Details:      
 
Domain Number 3 Region: 209-282
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 6.28e-22
Family Mib/herc2 domain 0.0011
Further Details:      
 
Domain Number 4 Region: 123-203
Classification Level Classification E-value
Superfamily RING/U-box 5.18e-20
Family ZZ domain 0.008
Further Details:      
 
Domain Number 5 Region: 953-1008
Classification Level Classification E-value
Superfamily RING/U-box 0.00000131
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017013
Domain Number - Region: 886-929
Classification Level Classification E-value
Superfamily RING/U-box 0.00771
Family RING finger domain, C3HC4 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017013   Gene: ENSMMUG00000012961   Transcript: ENSMMUT00000018174
Sequence length 1013
Comment pep:known chromosome:MMUL_1:1:4679454:4693061:1 gene:ENSMMUG00000012961 transcript:ENSMMUT00000018174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWKPSEARGQSQSLQASGLQPKSLKAAGRATGRPDRSRAARPTMDPSAHRSRAAPPNMDP
DPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGTRTN
YRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYMHNK
HELAHAFDRYETAHSRPVTLSPRQGLLRIPLRGIFQGAKVVRGPDWEWGSQDGGEGKPGR
VVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRLGKP
AELQRRVSADGQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRITDRG
DVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPALGR
VGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKL
RAQKSDPEHPGRLVVEVALGNMARALDLLRRPPAPVDTKNQGRTALQVAAYLGQVDLVRL
LLQARAGVDLPDDEGNTALHYAALGNQPEVGRVLLNAGCRADAINSTQSTALHVAVQRGF
LEVVRALCEHGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQGFTL
LHHASLKGHSLAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCDVNV
RNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVADGAG
GDPGPLQLMSRLQASGLPGSTELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEGRVL
KALQGCAQRFRERQAGGGAAPGLRHALGTPNTVTNLHVGAAPGPEAAECLVCSELALLVL
FSPCQHRTVCEECARRMKKCIRCQVALTPVPHPADGSEVASAAPAPGPPRQLVEELQSRY
RQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV
Download sequence
Identical sequences ENSMMUP00000017013 9544.ENSMMUP00000017013 ENSMMUP00000017013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]