SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017196 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017196
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-71
Family BAR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 383-498
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.54e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00016
Further Details:      
 
Domain Number 3 Region: 243-348
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-28
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 593-711
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-25
Family Ankyrin repeat 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017196   Gene: ENSMMUG00000013092   Transcript: ENSMMUT00000018366
Sequence length 761
Comment pep:known chromosome:MMUL_1:2:187493240:187609170:-1 gene:ENSMMUG00000013092 transcript:ENSMMUT00000018366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQYSSNDAVVE
TSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKFKDAKKQFEKVSEEKENA
LVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVLQSKRRSEILKSMLSFMY
AHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQKHSTIQQKDFSSDDSKL
EYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQKKFKDNPTVVVEDLRLCT
VKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSIATAYREKGDESEKLDKK
SSPSTGSLDSGSESKEKLLKGESALQRVQCIPGNASCCDCGLADPRWASINLGITLCIEC
SGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYEANVEKMGIKKPQPGQRQ
EKEAYIKAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLSISKFGPGDQVRASAQSS
VKSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSVFLDSKHLNPGLQLYRASYEK
NLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFLLQNGANVNQRDVQGRGP
LHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANADIVTLLRLARMNEEMRE
SEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
Download sequence
Identical sequences 9544.ENSMMUP00000017196 ENSMMUP00000017196 ENSMMUP00000017196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]