SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017206 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017206
Domain Number 1 Region: 8-190
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.73e-27
Family Clostridium neurotoxins, the second last domain 0.023
Further Details:      
 
Domain Number 2 Region: 282-402,467-534
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000308
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 413-575
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000188
Family Reprolysin-like 0.05
Further Details:      
 
Domain Number 4 Region: 1327-1390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000057
Family Complement control module/SCR domain 0.0053
Further Details:      
 
Domain Number 5 Region: 1263-1335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000473
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 6 Region: 1201-1267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000139
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 7 Region: 1132-1205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000222
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017206
Domain Number - Region: 588-624,803-857
Classification Level Classification E-value
Superfamily Fibronectin type III 0.004
Family Fibronectin type III 0.0093
Further Details:      
 
Domain Number - Region: 1471-1500
Classification Level Classification E-value
Superfamily Notch domain 0.0445
Family Notch domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017206   Gene: ENSMMUG00000013099   Transcript: ENSMMUT00000018376
Sequence length 1544
Comment pep:known chromosome:MMUL_1:15:19685776:19931974:-1 gene:ENSMMUG00000013099 transcript:ENSMMUT00000018376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGAAEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDK
CSYTSRDRGWVVGIHTISDQGNRDPRYFFSLKTDRARQVTTINAHRSYLPGQWVYLAATY
DGRFMKLYVNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNHNYRGYIEHFSLWKVAR
TQREILSDMETHGTHTALPQLLLQENWDNVKHAWSPMKDGSSPKVEFSNAHGFLLDTSLE
PPLCGQTLCDNTEVIASYNQLPSFRQPKVVRYRVVNLYEDDHKNPMVTREQVDFQHQQLA
EAFKHYNISWELKVLEVSNSSLRRRLILANCDISKIGDENCDPECNHTLTGHDGGDCRHL
RHPAFMKKQQNGVCDMDCNYERFNFDGGECCDPKITDVTQTCFDPDSPHRAYLDVNELKN
ILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGMPGHTHTMIHE
IGHSLGLYHVFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKSCGDPGPGNDTCG
FHSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQSWQPSRKPAPVALAPQVVG
HTTDSVTLEWFPPIDGHFFERELGSACDLCLEGRILVQYAFNASSPMPCSPSGHWSPREA
EGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFLYPLVPESLTIWVTFV
STDWDSSGAVNDIKLLTVSGKNISLGPQNVFCDIPLTIRLQDVGEEVYGIQIYTLDEHLE
IDAAMLTSTADTPLCLQCKPLQYKVVRDPPLQVDVASILHLNRKFIDMDLNRSSVYQYWV
ITISGTEESEPSPAVTYIHGSGYCGDGIIQKDQGEECDDLNKINGDGCSLFCRQEVSFNC
IDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVIIG
QPAASQVCRTKVIDLSEGISQHAWYPCTISYPYSQLAQTTFWLRAYFSQPMVAAAVIVHL
VTDGTYYGDQKQETISVQLLDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSQPFYHSQAVR
VSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSPAEQSCVHFACENTDCPELAVENA
SLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQMGPSVTVTCTEGKWNKQVACEPV
DCSIPDHHHVYAASFSCPNGTTFGSQCSFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCE
LMCLAPPPVPNADLQTPRCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCTQDG
SWQEGACVPVTCDPPPSKFHGLYQCTNGFQFNSECRIKCEDSDASQGRGSNIINCRKDGT
WSGSFHVCQEMQGQCSAPNQLNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVR
DIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDC
CTSTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHR
Download sequence
Identical sequences ENSMMUP00000017206 ENSMMUP00000017206 9544.ENSMMUP00000017206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]