SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017212 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017212
Domain Number 1 Region: 144-477
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.59e-52
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000019
Further Details:      
 
Domain Number 2 Region: 482-611
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.78e-31
Family Ricin B-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017212   Gene: ENSMMUG00000013106   Transcript: ENSMMUT00000018382
Sequence length 614
Comment pep:known chromosome:MMUL_1:5:165300410:165377311:1 gene:ENSMMUG00000013106 transcript:ENSMMUT00000018382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDRDVNDPMPNRGGNGLAPGEDRFKPVVPWPHVEGVEVDLESIRRKNKAKNEQEHHAGGD
SQKDIMQRQYLTFKPQTFTYRDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEF
KHAIQASIKEFGFNMVASDMISLDRSVNDLRQEECKYWHYDENLLTSSVVIVFHNEGWST
LMRTVHSVIKRTPRKYLAEIVLIDDFSNKEHLKEKLDEYIKLWNGLVKVFRNERREGLIQ
ARSIGAQKAKLGQVLIYLDAHCEVAVNWYAPLVAPISKDRTICTVPLIDVINGNTYEIIP
QGGGDEDGYARGAWDWSMLWKRVPLTPQEKRLRKTKTEPYRSPAMAGGLFAIEREFFFEL
GLYDPGLQIWGGENFEISYKIWQCGGKLLFVPCSRVGHIYRLEGWQGNPPPIYVGSSPTL
KNYVRVEVCGDEYKDYFYASRPESQALPYGDISELKKFREDHNCKSFKWFMEEIAYDITS
HYPLPPKNVDWGEIRGFETAYCIDSMGKTNGGFVELGPCHRMGGNQLFRINEANQLMQYD
QCLTKGADGSKVMITHCNLNEFKEWQYFKNLHRFTHIPSGKCLDRSEVLHQVFISNCDSS
KTTQKWEMNNIHSV
Download sequence
Identical sequences 9544.ENSMMUP00000017212 ENSMMUP00000017212 ENSMMUP00000017212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]