SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017231 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017231
Domain Number 1 Region: 41-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 2 Region: 154-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000791
Family Pentraxin (pentaxin) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017231   Gene: ENSMMUG00000029448   Transcript: ENSMMUT00000018401
Sequence length 568
Comment pep:known chromosome:MMUL_1:4:121302178:121336241:-1 gene:ENSMMUG00000029448 transcript:ENSMMUT00000018401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WFFSSSRRFHFPFIFYDRMLVFLNIYCSIVPIWPAVWGCANCRVVLSNPSGTFTSPCYPN
DYPNSQACKWALRAPAGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLS
FNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSVSIPE
LSAFTLCFEATKVGHEDNDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPV
KEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNE
IVSLKGDIYNFRLWNFTMNAKILSNLSCNMKGNVVDWQNDFWNIPNLALKAESNLSCDQG
SYLIPLPAAELASCADLGTLCQDGIIYRISVVIQNILRHPEVKVQSKVAEWLNSTFENWN
YTVYVINISFHLSGGEDKIKVKRSIENEPRLVLWALLVYNATNNTNLEGKIIQQKLLKNN
ESLDEGLRLHTVNVRQLGYCLAVEEPKGYYWPSIQPSEYVLPCPDKPDFSASRICYATNK
SVAYWGPPDISSCSTVLTVTCLSLLLSK
Download sequence
Identical sequences 9544.ENSMMUP00000017231 ENSMMUP00000017231 ENSMMUP00000017231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]