SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017305 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017305
Domain Number 1 Region: 249-586
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.65e-37
Family WD40-repeat 0.0048
Further Details:      
 
Domain Number 2 Region: 17-138
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000000000000361
Family Quinoprotein alcohol dehydrogenase-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017305   Gene: ENSMMUG00000013173   Transcript: ENSMMUT00000018481
Sequence length 675
Comment pep:known chromosome:MMUL_1:20:649286:654424:1 gene:ENSMMUG00000013173 transcript:ENSMMUT00000018481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSASLDELLRVDIGTLDLASGRLDSAMAVCFGPAALGHLLVSTSSNRVMVLDAASGRII
RELPSVHPEPCSSLMLSEDARFLLMAAGRAVKVWDYTTQANPGPQVYIGHSEPVQAVTFS
PDQQQVLSAGDAIFLWDILATTERQVDQRFPGPSPACEAGLGTGQLEDAASRASELPRQQ
VPKPSQASPPRLGICARPPEGGDGTSDTKNSGAPRTTCPASHKAFTPARASRGPHSAKGT
SLPPASSEWLRLKAVVGYSGNGRANMVWRPDTGFFAYTCGHLVVVEDLHSGAQQHWPGHP
AEISTLALSHSAQVLASASGRSSTTDHCQIRVWDVSGGLCQHLISHHSTTVLALAFSPDD
RLLVTLGDHDGRTLALWGTASYDLVSSTRLPEPVHGVAFNPWDAGELACVGQGTVTFWLL
QQRGADISLQVHREQVPETVGAGELTSLCYGAHPLLYCGTSSGQVCVWDTRAGRCFLSWE
ADDGGIGLLLCSSSRLVSGSSTGRLRLWAVGPVSELRCKGSGARSSSVFMERELVLDGAV
VSASFDGSVDMGVVGTRAGTLWFISWAEGTSTRLISGHRSKVRDFQPRQRQGSRTWPSCL
LAPSPPAQIIPSPAVSGSQRPPWGSQEEGFGCARPSAIPVVSAPGSRLAGLASVLKPSFP
CYCFEFFCFVLFCFL
Download sequence
Identical sequences ENSMMUP00000017305 ENSMMUP00000017305 9544.ENSMMUP00000017305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]