SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017346 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017346
Domain Number 1 Region: 60-194
Classification Level Classification E-value
Superfamily NTF2-like 2.26e-46
Family NTF2-like 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017346   Gene: ENSMMUG00000013204   Transcript: ENSMMUT00000018522
Sequence length 197
Comment pep:known chromosome:MMUL_1:X:108258472:108264096:1 gene:ENSMMUG00000013204 transcript:ENSMMUT00000018522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKCRSHWSQGDRERHQRRSHYYEGPHTSHSSCGGRTREEVVTPPLPEHAAAGSPMAMSV
DFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNVVSGLDALNNFFDT
LPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHYFNQNFLLTAQSTPNNT
VWKIASDCFRFQDWSSS
Download sequence
Identical sequences F6XGA9 G7Q3G2
ENSMMUP00000017346 ENSMMUP00000017345 NP_001252636.1.72884 XP_005594399.1.63531 9544.ENSMMUP00000017345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]