SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017447 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017447
Domain Number 1 Region: 6-138
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 5.23e-31
Family Ribosomal proteins L15p and L18e 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017447   Gene: ENSMMUG00000013264   Transcript: ENSMMUT00000018626
Sequence length 143
Comment pep:known chromosome:MMUL_1:6:71200052:71200527:-1 gene:ENSMMUG00000013264 transcript:ENSMMUT00000018626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRLRKTWQLRGHVSHGHGRTGKHQKHPRGHGNAGGLHHHRLSFDKYQPGYFGKVGMRH
YHLKRSQSFCPPVNLDKLWTLVNEQTRGNAGAAPIIDVVRSGYCKVLGKEKLPKQPVIVK
AKFFSRRAEEILKPHGGRGSLNA
Download sequence
Identical sequences ENSMMUP00000017447 9544.ENSMMUP00000017447 ENSMMUP00000017447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]