SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017461 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017461
Domain Number 1 Region: 1-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.77e-57
Family IMD domain 0.00000563
Further Details:      
 
Domain Number 2 Region: 271-351
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000158
Family SH3-domain 0.0000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017461   Gene: ENSMMUG00000013276   Transcript: ENSMMUT00000018640
Sequence length 442
Comment pep:known chromosome:MMUL_1:3:45472815:45502077:-1 gene:ENSMMUG00000013276 transcript:ENSMMUT00000018640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLKRYQTEHKNKLE
SLEKSQAELKKIRRKSQGGRNALKYEHKEIEYVETVTSRQSEIQKFIADGCKEALLEEKR
RFCFLVDKHCGFTNHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIKTPAS
TPVSGTPQPSPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATAAPNS
QKINNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGANKTLLSFAQGDVITLLI
PEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSLSPAPVRSISTVNLSEN
SSVVIPPPDYLECLSMGAAADRRADAARTTSTFKAPASKPETTAPNDANGTAKPPFLSGE
NPFATVKLRPTVTNDRSAPIIR
Download sequence
Identical sequences ENSMMUP00000017461 9544.ENSMMUP00000017461 ENSMMUP00000017461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]