SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017503 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017503
Domain Number 1 Region: 42-300
Classification Level Classification E-value
Superfamily Aldolase 1.88e-77
Family Class I aldolase 0.00000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017503   Gene: ENSMMUG00000013309   Transcript: ENSMMUT00000018683
Sequence length 318
Comment pep:known chromosome:MMUL_1:11:16317036:16446286:1 gene:ENSMMUG00000013309 transcript:ENSMMUT00000018683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAHNRGTELDLSWISKIQVNHPAVLRRAEQIQARRTVKKEWQAAWLLKAVTFIDLTTLS
GDDTSSNIQRLCYKAKYPIREDLLKALNMYDKGITTAAVCVYPARVCDAVKALKAAGCNI
PVASVATGFPAGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRK
ACGEAHLKTILATGELGSLTNVYKASMIAMMAGSDFIKTSTGKETVNATFPVAIVMLRAI
RDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEWLKPELFRIGASTLLSDIERQ
IYHHVTGRYAAYHDLPMS
Download sequence
Identical sequences A0A0D9R7I1 A0A2I3N060 A0A2K5J1C3 A0A2K5MA98 A0A2K5U9U9 A0A2K5XZ81 A0A2K6ED78 F6XLA4
XP_005570308.1.63531 XP_007965965.1.81039 XP_011739526.1.29376 XP_011739532.1.29376 XP_011809877.1.43180 XP_011846218.1.47321 XP_011913835.1.92194 XP_015006693.1.72884 9544.ENSMMUP00000017503 ENSMMUP00000017503 ENSMMUP00000017503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]