SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017583 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017583
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily ENTH/VHS domain 6.15e-52
Family VHS domain 0.000000105
Further Details:      
 
Domain Number 2 Region: 150-303
Classification Level Classification E-value
Superfamily GAT-like domain 8.11e-33
Family GAT domain 0.000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017583   Gene: ENSMMUG00000013383   Transcript: ENSMMUT00000018776
Sequence length 492
Comment pep:known chromosome:MMUL_1:10:79210034:79257973:1 gene:ENSMMUG00000013383 transcript:ENSMMUT00000018776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLGNPFSSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVG
NKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVESVLVRTILPKNNPPTIVHDKVLNL
IQSWADAFRSSPDLTGVVTIYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDS
VGSDASQQEDSGQHTAPLPTPPMLSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTE
LVPTQVEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHER
FERFRTGQTTKAPSEAEPAADLIDMGPEPAATGNLSSQLAGMNLGSSSVRAGLQSLEASG
RLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDI
EQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPPGPAPRKK
TQEKDDDMLFAL
Download sequence
Identical sequences A0A2K6CFQ3 F6QK45 G7PFA5
ENSPANP00000013218 ENSMMUP00000017583 NP_001253092.1.72884 XP_005567527.1.63531 XP_011760324.1.29376 9544.ENSMMUP00000017583 ENSMMUP00000017583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]