SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017609 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017609
Domain Number 1 Region: 255-466
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-53
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 557-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000118
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 3 Region: 905-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000876
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 856-909
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017609   Gene: ENSMMUG00000013407   Transcript: ENSMMUT00000018804
Sequence length 967
Comment pep:known chromosome:MMUL_1:3:19821592:19830686:1 gene:ENSMMUG00000013407 transcript:ENSMMUT00000018804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAVPEGFGRRKLGSDMGNAERAPGSRSFGPVPTLLLLAAALLAVSDALGRPSEEDEEL
VVPELERAPGHGTTRLRLHAFDQQLHLELRPDSSFLAPGFTLQNVGRKPGSETPLPEPDL
AHCFYSGTVNGDPSSAAALSLCEGVRGAFYLRGEAYFIQPLPAASERLATAAPGEKPPAP
LQFHLLRRNRQGDGGGTCGVVDDEPRPTGKAETEDENEGNEGEDEGAQWSPQDPALQRVG
QPTGTGSIRKKRFVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRN
SVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQD
LCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASL
NGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPQNPIQLPGDLPGT
SYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWC
INGKCVNKTDRKHFDTPFHGSWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEG
KRVRYRSCNIEDCPDNNGKTFREEQCEAHNEFSKASFGSGPAVEWIPKYAGVSPKDRCKL
ICQAKGIGYFFVLQPKVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGVCGGN
GSTCKKISGSVTSAKPGYHDIITIPTGATNIEVKQRNQRGSRNNGSFLAIKAVDGTYILN
GDYTLSTLEQDIMYKGVVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTY
FVKKKKESFNAIPTFSAWVIEEWGECSKSCELGWQRRLVECRDINGQPASECAKEVKPAS
TRPCADHPCPQWQLGEWSSCSKTCGKGYKKRSLKCLSHDGGVLSHESCDPLKKPKHFIDF
CTMAECS
Download sequence
Identical sequences A0A2K5WXG9 G7MNA9
ENSMMUP00000017609 NP_001253193.1.72884 XP_005548937.1.63531 ENSMMUP00000017609 9544.ENSMMUP00000017609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]