SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017639 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017639
Domain Number 1 Region: 37-84
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 4.97e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017639   Gene: ENSMMUG00000013426   Transcript: ENSMMUT00000018837
Sequence length 367
Comment pep:known chromosome:MMUL_1:19:48157821:48165370:1 gene:ENSMMUG00000013426 transcript:ENSMMUT00000018837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSDMPAGYHCPSDSAPQNETRDPQGTELIPRRAISRSPTCARCRNHGVTAHLKGHKRL
CLFQACECHKCVLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTARP
QVPSGKENIAPQPQTPHGAVLLAPTPPGKNSCGPLLLSRPPEALPLSWTPVPPGPWVPGH
WLPPGLSMPPPVVCRLLYQEPALSLPPFPGFDPGTSLQLPTHGPFTTCPGSHPVLTAPLS
GEPQGPPSQPRTHSTLILQPCGTPDPLQLQPQASGASRLARTSAPSERQLQQEAAEALVG
LKDSSQAPRVTPSVPPNPAWISLLHPCGPPAPAGGRGFQPVGPCLRPSPAPSVALHIGRL
GSISLLS
Download sequence
Identical sequences A0A2K5VUM8 A0A2K5XQI0
ENSMMUP00000017639 XP_001103345.1.72884 XP_005589481.1.63531 XP_011838586.1.47321 9544.ENSMMUP00000017639 ENSMMUP00000017639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]