SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017648 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017648
Domain Number 1 Region: 269-379
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000051
Family Second domain of FERM 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017648
Domain Number - Region: 30-166
Classification Level Classification E-value
Superfamily ARM repeat 0.0127
Family MIF4G domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017648   Gene: ENSMMUG00000013433   Transcript: ENSMMUT00000018846
Sequence length 487
Comment pep:known chromosome:MMUL_1:16:70930515:70936559:1 gene:ENSMMUG00000013433 transcript:ENSMMUT00000018846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEFALRYFRKSQALPGQTDEGATGKDTDSLVQYTKAPIQESLLSLSDDVNKLAVASFLA
LMRFMGDQSKPRGKDEMDLLYELLKLCQEEKLRDEIYCQVIKQVTGHPRPEHCTRGWSFL
SLLTGCFSPSTRLMPYLTKFLQDSGPSQELARSSQEHLQRTVKYGGRRWMLPPGEMKAFL
KGQATRLLLIHLPGGVDYKTNIHTFTVAAEVQEELCQQMGITEPQEVQEFTLFLIKEKGK
LVRPLRPAEYLNSVAVDQDVSLHSRRLGWETPLHFDNSIYISTHYSQVLRDYLQGKLPVS
AKADAQLARLAALQHLSKANRNTPSEQDLLAYVPQQLQRQVNMASIKNLMGQELRQLGGH
SPQEAQISFIEAVSQLPLFGYTVYVALRVSMQALSGPALLGLNRQHLILMDPSSQNLYCR
IALKSLQRLHLLSPLEEKGPPGLELNYGSADNPQTIWFELPQAQELLYTTVFLIDSSASC
TEWPSVN
Download sequence
Identical sequences G7NGQ1
ENSMMUP00000017648 ENSMMUP00000017648 9544.ENSMMUP00000017648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]