SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017668 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017668
Domain Number 1 Region: 606-810
Classification Level Classification E-value
Superfamily Fibronectin type III 7.94e-34
Family Fibronectin type III 0.00000283
Further Details:      
 
Domain Number 2 Region: 316-407
Classification Level Classification E-value
Superfamily Immunoglobulin 2.61e-22
Family I set domains 0.0076
Further Details:      
 
Domain Number 3 Region: 237-326
Classification Level Classification E-value
Superfamily Immunoglobulin 9.12e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 4 Region: 36-123
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000166
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 468-574
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000177
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 6 Region: 136-211
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000275
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017668   Gene: ENSMMUG00000013443   Transcript: ENSMMUT00000018867
Sequence length 1116
Comment pep:known chromosome:MMUL_1:2:33242018:33317641:1 gene:ENSMMUG00000013443 transcript:ENSMMUT00000018867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGTMTAWRGTRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVE
PPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPA
TVTLANLEDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRGNYLIM
PSGNLQIVNASQEDEGMYKCAAYNPVTQEVKTSGSSDRLRVRRSTAEAARIIYPPEAQTI
IVTKGQSLILECVASGIPPPRVTWAKDGSSVAGYNKTRFLLSNLLIDTTSEEDSGTYRCM
ADNGVGQPGAAVILYNVQVFEPPEVTMELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNA
TPLISSQRLQLSRRALRVLSMGPEDEGVYQCMAENEVGSAHAVVQLRTSRPSITARLRQD
AEPATGTSPAPPSKPGSPEQMLRGEPALPRPPTSARPASPQCPGEKGQGAPAEAPIILSS
PRTSKTDSYELVWRPRHEGSGWAPILYYVVKHRKQVTNSSDNWTISGIPANQHRLTLTRL
DPGSLYEVEMAAYNCAGEGQTAMVTFRTGRRPKPEIMASKEQQIQRDDPGASPQSSSQPD
HGRLSPPEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAI
PPSRLSVEITGLEKGTSYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYIT
FTDAVNETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDRYWHSISH
LQPETSYDIKMQCFNEGGESEFSNVMICETKARKSSGQPGRLPPPTLAPPQPPPPETIER
PVGTGAMVARSSDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALPP
SSCPYTMVPLGGLPGHQTSGQRYLSGISGRACANGIHVNRGCPAAAVGYPGMKPQQHCPG
ELQQQNDTSRLLRQTHLGNGYDPQSHQITRDPESSPDEGSFLYTLPDDSTRQLLQPHHDC
CQRREQPAAVGQSGVRRAPDSPVLEAMWDPPFHSGPPCCLGLVPVEEVDSPDSCQVGGGD
WCPQHPTGAYVGQEPGMQLSPGPPVCVSFETPLPTI
Download sequence
Identical sequences ENSMMUP00000017668 ENSMMUP00000017668 XP_014985359.1.72884 XP_014985360.1.72884 XP_014985361.1.72884 XP_014985362.1.72884 XP_014985363.1.72884 9544.ENSMMUP00000017668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]