SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017718 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017718
Domain Number 1 Region: 155-379
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 3.36e-93
Family Guanido kinase catalytic domain 0.00000000116
Further Details:      
 
Domain Number 2 Region: 3-93
Classification Level Classification E-value
Superfamily Guanido kinase N-terminal domain 5.63e-23
Family Guanido kinase N-terminal domain 0.0000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017718   Gene: ENSMMUG00000013477   Transcript: ENSMMUT00000018917
Sequence length 380
Comment pep:known chromosome:MMUL_1:19:51741480:51753381:-1 gene:ENSMMUG00000013477 transcript:ENSMMUT00000018917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLDLYKKLRDKETPSGFTLDDVIQTG
VDNPGEPPCTRIPCRSQGEESWEYLPSRFPPVLSLMLRGEEERDHRRDGGREKYRDTEKK
GTNACRKGRGREQQQGEPWASTPWLKWDRLPTTPSCVPIALNSLTGEFKGKYYPLKSMTE
KEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISME
KGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAH
LSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMV
EMEKKLEKGQSIDDMIPAQK
Download sequence
Identical sequences ENSMMUP00000017718 9544.ENSMMUP00000017718 ENSMMUP00000017718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]