SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017722 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017722
Domain Number 1 Region: 3-420
Classification Level Classification E-value
Superfamily Peptidase/esterase 'gauge' domain 2.14e-119
Family Prolyl oligopeptidase, N-terminal domain 0.0000000000000874
Further Details:      
 
Domain Number 2 Region: 435-704
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.54e-48
Family Prolyl oligopeptidase, C-terminal domain 0.000000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017722   Gene: ENSMMUG00000013483   Transcript: ENSMMUT00000018924
Sequence length 710
Comment pep:known chromosome:MMUL_1:4:101282576:101415543:-1 gene:ENSMMUG00000013483 transcript:ENSMMUT00000018924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR
GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGDARVFLDPNILS
DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTH
DGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAEL
SDDGRYVLLSIREGCDPVNRLWYCDLQQESNGITGILKWVKLIDNFEGEYDYVTNEGTVF
TFKTNRHSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNI
LQLHDLTTGALLKTFPLEVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPR
VFREVTVKGIDASDYQTVQIFYLSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKE
GYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYG
CSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIV
GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIDWIP
Download sequence
Identical sequences F6ZLE6
NP_001244843.1.72884 ENSMMUP00000017722 9544.ENSMMUP00000017722 ENSMMUP00000017722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]