SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017731 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017731
Domain Number 1 Region: 2-169
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.53e-40
Family Regulator of chromosome condensation RCC1 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017731   Gene: ENSMMUG00000013491   Transcript: ENSMMUT00000018934
Sequence length 758
Comment pep:known scaffold:MMUL_1:1099553000029:35320:84878:-1 gene:ENSMMUG00000013491 transcript:ENSMMUT00000018934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSCGDEHTAIVTTDGELYMFGEPENGKLGLPNQLLSNHRTPQLVSEIPEKVIQVACGGEH
TVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDHTISYISCGENHTALITDIG
LMYTFGDGRHGKLGLGLENFTNHFTPTLCSNFLRFIVKLVACGGCHMVVFAAPHRGVAKE
IEFDEISDTCLSVATFLPYGSLTSGNVLQRTLSARMRRRERERSPDSISMMRTLPPIEGT
LGLSACFPPNSVFARCSESNLLPSVLSEQDLMHPEEPDYFLDEMTKEAEIDNSSTVESLG
ETTDILNMTHIMSLNSNEKSLKLSPVQKQKKQQTIGELMQHTALTENDDSDEYEEMSEMK
EGKACEQHVSRGIFMTQPATPIEAFSDEELGNDSGQVGPQADTDGEGLQKEVFRHENNNG
VDQLDAKEIEKESDGGHSQKESEAEEIVSEKETKLAEIAGMKDLRKREKSTKNMSSFFGN
LPDRGMNTESEENKDFVKKRESCKQDVIFDSERESVEKLDYMESASESQQGIADGFQQPE
AIEFSSGEKEDDEVETDQNIWYGRKLIEQGNEKETKPVISKSMAKYDFKCDRLSEIPEEK
EGAEDSKGNGIEEQEVEANEENVKVHGGRQEETEILSDDLTDKAEDDEFSKTEELQLEDV
DEEINAENLESKKKIVGDDESVPTGSHSKTEGAERTSDDSSAETIEKKEKANLEERAICE
YNENPKGYMLGDAESSSLEILENSESTPSNDMKKTQKV
Download sequence
Identical sequences ENSMMUP00000017731 ENSMMUP00000017731 9544.ENSMMUP00000017731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]