SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017827 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017827
Domain Number 1 Region: 380-416
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000034
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017827   Gene: ENSMMUG00000013555   Transcript: ENSMMUT00000019032
Sequence length 621
Comment pep:known chromosome:MMUL_1:7:140627947:140649775:-1 gene:ENSMMUG00000013555 transcript:ENSMMUT00000019032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALRDRAGLLLCVLLLVALLAVARGLPARKPGRGGPGPGNLTRLAEVRGGGTGLRAVPP
PRPAGSSRAGSGTGTYTGCDPPERGARAGRKLPDTERWPVTEGSTVQLIVPWNAADVHSH
GHKDSQTCIRVCRSRPVWQVAFGLGSWVLPSTELWEASPHDIPCEQNVAPASLGRSVAEP
QFTPTVKPRLQIHKLRVPPMAPVCLLTPEPLTQASASPDPRPLREEEEAPLLPRTRLQAE
PHQHGHRTVTEPAALTPGNATPPRTPEVTPLLLELQTLPGSANTTLSTPNPDIQVNIEVV
EDPQAQVEIDLLAEPSDTPPKDTLSWLPDLWSFLWGDYKGDKKDRAPFWFNGTTDNWDQG
WLAPGNWVLKDSVSYDYEPQEEWGPWSPCRGNCSIGNQQRTRPCGLGCVVTQTRTCDLPN
CPGTEDKDTLGLLEEWQLLARNATDMPDQDVDYCEKWLNCKSDFLTKYLSQMLRDLPSCP
CAYPLEARDSPVSLQDEHQGRSFRWRDASSPRERLDIYQPTARFCLRSMLSRNSSTLAAQ
HCCYDDDSRLLTRGKGAGMPDLISTDFSPELHFKFDTTPWILCKGDWSRLHAMLPPNNGR
ACTNNPPEEEYLAQLQEAKEY
Download sequence
Identical sequences 9544.ENSMMUP00000032699 ENSMMUP00000017827 ENSMMUP00000032699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]