SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017856 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017856
Domain Number 1 Region: 553-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-68
Family Protein kinases, catalytic subunit 0.00000106
Further Details:      
 
Domain Number 2 Region: 1-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-59
Family FCH domain 0.00083
Further Details:      
 
Domain Number 3 Region: 451-552
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-31
Family SH2 domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017856   Gene: ENSMMUG00000013582   Transcript: ENSMMUT00000019065
Sequence length 823
Comment pep:known chromosome:MMUL_1:6:105148060:105525992:1 gene:ENSMMUG00000013582 transcript:ENSMMUT00000019065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQ
MNYVSNVSKSWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYLGVHQQ
IEAEMIKVTKTELEKLKSSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHM
LHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEI
VNVHKEIQMSVEQIDPSTEYNNFIDVHRTTADKEQEIEFDTSLLEENENLQANEIMWNNL
TAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQAL
EELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSK
FESIRHSIAGIIRSPKSALSSSALSDMISISEKPLAEQDWYHGAIPRIEAQELLKKQGDF
LVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITK
KSGVVLLNPIPKDKKWILSHEDVTLGELLGKESAMGEYCHGNKRTIHNKAVNLFHDFFML
KMKLTFMQTSKILKQYDHPNIVKLIGVCTQRQPVYIIMELVSGGDFLTFLRRKKDELKLK
QLVKFSLDAAAGMLYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGL
KQIPIKWTAPEALNYGRYSSESDVWSFGILLWETFSLGVCPYPGMTNQQAREQVERGYRM
SAPQNCPEDIFKIMMKCWDYKPENRPKFSELHKELTIIKKKLT
Download sequence
Identical sequences G7P814
ENSMMUP00000017856 9544.ENSMMUP00000017856 ENSMMUP00000017856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]