SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017958 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017958
Domain Number 1 Region: 80-194
Classification Level Classification E-value
Superfamily Translational machinery components 1.57e-38
Family Ribosomal protein L18 and S11 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017958   Gene: ENSMMUG00000013659   Transcript: ENSMMUT00000019176
Sequence length 194
Comment pep:known chromosome:MMUL_1:7:68083293:68094130:1 gene:ENSMMUG00000013659 transcript:ENSMMUT00000019176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVRNVGSWFLRSWTWPQTTGVVARTPARTIHTDARQLQDAAAKQEVEEKAAAPSHTRF
SIYPPIPGEESSLRWAGKKFEEIPIAHIKASYNNTQIQVVSASNEPLARASCGTEGFRNS
KKGTGIAAQTAGIAAAAKATQKGVTHIRVVVKGLGPGRLSAIHGLTMGGLEVISITDNTP
IPHNGCRPRKARRL
Download sequence
Identical sequences A0A2K5U9K8 F7GG48
ENSMMUP00000017958 NP_001248507.1.72884 XP_014998424.1.72884 9544.ENSMMUP00000017958 ENSMMUP00000017958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]