SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017977 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017977
Domain Number 1 Region: 1309-1386
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 923-996
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000105
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 706-759
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000405
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 1204-1284
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000277
Family I set domains 0.034
Further Details:      
 
Domain Number 5 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 571-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 9 Region: 1426-1483
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number 10 Region: 1487-1544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000458
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 11 Region: 760-819
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000471
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 12 Region: 815-880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 13 Region: 1600-1655
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000968
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 14 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 647-703
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000497
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017977   Gene: ENSMMUG00000013670   Transcript: ENSMMUT00000019195
Sequence length 1691
Comment pep:known chromosome:MMUL_1:7:62443301:62859649:-1 gene:ENSMMUG00000013670 transcript:ENSMMUT00000019195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWTSPWWLLMGMVFMHSTLQETTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNTHSDEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYRTCSN
HDCPPDTEDFRAQQCSAYNDVQYQGRYYEWLPRYNDPAAPCALKCHARGQNLVVELAPKV
LDGTRCNTDSLDMCISGICQAVGCDRQLGSNAKEDNCGVCAGDGSTCRLVRGQSKSHVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFVVENTTVEFQR
GSERQTFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHRGEHVGGCNPQLKLHIKEECVIPIPCYKPKEK
SPVEAKLPWLKQAQELEETRIATEEPTFIPDPWSACSTTCGPGVQVREVKCRVLLTFTQT
ETELPEEECEGPKLPTERPCLLEACDESLASRELDIPLPEDSEMTYDWEYAGFTPCTATC
LGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWDMGSWGPCSATCG
VGIQTRDVYCLHPGETPAPPEECRDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGGGTQ
NRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGVGIQ
RRKQVCQRLTAKGRLVPLSEMMCRDLPGLPLVRSCQTPECSKIKSEMKTKLGEQGPQILS
VQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLG
ITKSGSLKIHSLATPDIGVYRCIAGSAQETVVLKLIGTDNRLIARPALREPMREYPGMDH
NEANSLGVTWHKMRQMWNNKNDLYLDDDYISNQPFLRALLGHCSSSAGNTNSWELKNKQF
EAAVKQGAYSMDTAQFDELIRNMSQLMETGEVSDDLASQLIYQLVAELAKAQPTHMQWWG
IQEEMPPAAQLRGETGSVSQSSNAKNSGKLTFKPKGPVLMRQSQPPSISFNKTINSRIGN
TVYITKRTEVINILCDLITPGEATYTWTKDGTLLQPSVKIILDGTGKIQIQNPTRKEQGI
YECSVANHLGSDVESSSVLYAEAPVILSIERNITKPEHNHLSVMVGGIVEAALGANVTIR
CPVKGVPQPNITWLKRGGSLSGNVSLLFNGSLLLQNVSLENEGTYVCTATNALGKAVATS
VLHLLERRWPESKIVFPQGHKKYVLQATNTRTNSNDPTGEPLPQEPFWEPGNWSRCSATC
GHLGARIQRPQCVMANGQEVSEALCDHLQKPLAGFQPCNIRDCPARWFTSMWSQCSVSCG
EGYHSRQVMCKQTKANGTVQVVSPRACAPKDRPLGRKPCFGHPCVQWEPGNQCPGRCMGH
AVRMQQHHTACQHNGSDSNCDDRRRPALRRNCTSGACDVCWHAGPWKPCTAACGRGLQSR
KVDCIHTRSCKPVAERHCVQKKKPVSWRHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDLY
KQRCCQSCQEG
Download sequence
Identical sequences ENSMMUP00000017977 ENSMMUP00000017977 9544.ENSMMUP00000017977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]