SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017984 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017984
Domain Number 1 Region: 380-483,528-582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-19
Family SPRY domain 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017984
Domain Number - Region: 111-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.013
Family PHD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017984   Gene: ENSMMUG00000013675   Transcript: ENSMMUT00000019202
Sequence length 621
Comment pep:known chromosome:MMUL_1:8:38558482:38594267:1 gene:ENSMMUG00000013675 transcript:ENSMMUT00000019202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGAGPGQEAGAGPGPGAAANATAAEEGEMKPVAAGAAAPPGEGTSAPPTAEPSSGEA
EGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVDEENGRQLGEVELQCGIC
TKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQS
RTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHP
DPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGIAAGSSGKGRGAKR
KQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLEL
DCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGA
WYFEITVDEMPPDTAARLGWSQPLDREDRPSGQGLRLRGCWVLLEKMCEFRHFYGYFYCG
VYVFILEVCNNSKSSKTELVFKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNG
VNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTL
ADVLYHVETEVDGRRSPPWEP
Download sequence
Identical sequences ENSMMUP00000017984 ENSMMUP00000017984 9544.ENSMMUP00000017984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]