SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018099 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018099
Domain Number 1 Region: 193-278
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.7e-24
Family Thyroglobulin type-1 domain 0.00000603
Further Details:      
 
Domain Number 2 Region: 50-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.02e-18
Family Growth factor receptor domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018099   Gene: ENSMMUG00000013765   Transcript: ENSMMUT00000019328
Sequence length 281
Comment pep:known chromosome:MMUL_1:3:80604053:80608754:-1 gene:ENSMMUG00000013765 transcript:ENSMMUT00000019328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHRPPPPAQRASAPVCCPRLEMSEVPVARVWLVLLLLTVQVGVTASAPWQCAPCSAEKL
ALCPPVPASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALT
RGQGACVQDSDASASNAEAAGSPESPESTEITEEELLDNFHLMAPSEEDHSTLWDAIGTY
DSSKAVHVTNVKKWKEPCRIELYRVVESLTKAQETSGEDISKFYLPNCNKNGFYHSRQCE
TSLAGEERLCWCVYPWNGKRIPGSPEIRGDPNCQTYFNVQN
Download sequence
Identical sequences A0A1D5QTL3 A0A2K5WDT6 A0A2K6CCK7
9544.ENSMMUP00000018099 XP_001085935.2.72884 XP_005549699.1.63531 XP_011760840.1.29376 ENSMMUP00000018099 ENSMMUP00000018099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]