SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018152 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018152
Domain Number 1 Region: 512-637,678-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-45
Family Protein kinases, catalytic subunit 0.0000125
Further Details:      
 
Domain Number 2 Region: 227-415
Classification Level Classification E-value
Superfamily Fibronectin type III 6.5e-29
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 3 Region: 48-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000153
Family V set domains (antibody variable domain-like) 0.0000748
Further Details:      
 
Domain Number 4 Region: 142-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000218
Family I set domains 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018152   Gene: ENSMMUG00000013803   Transcript: ENSMMUT00000019382
Sequence length 889
Comment pep:known chromosome:MMUL_1:7:19947665:19971062:1 gene:ENSMMUG00000013803 transcript:ENSMMUT00000019382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRRSMGRPGLPPLLLPPPPRLGLLLAALASLLLPESAAAGLKLMGAPVKLTVSQGQPV
KLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLTARLLKSAERSDAGRYWC
QVEDGGETEISQPVWLTVEGVPFFTVEPKDLAVPPNAPFQLSCEAVGPPEPVTIVWWRGT
TKIGGPAPSPSVLNVTGVTQSTMFSCEAHNLKGLASSRTATVHLQALPAAPFNVTVTKLS
SSNASVAWMPGADGRALLQSCTVQVTQAPGGWEVLAVVVPVPPFTCLLRDLVPATNYSLR
VRCANALGPSPYADWVPFQTKGLAPASAPQNLHAIRTDSGLILEWEEVIPEGPLEGPLGP
YKLSWVQDNGTQDELTVEGTRANLTGWDPQKDLIVRVCVSNAVGCGPWSQPLVVSSHDHA
GQQGPPHSRTSWVPVVLGVLTALVTAAALALILLRKRRKETRFGQAFDSVMARGEPAVHF
RAARSFNRERPERIEATLDSLGISDELKEKLEDVLIPEQQFTLGRMLGKGEFGSVREAQL
KQEDGSFVKVAVKMLKADIIASSDIEEFLREAACMKEFDHPHVAKLVGVSLRSRAKGRLP
IPMVILPFMKHGDLHAFLLASRIGENPFVRLMELGGSRRGLSLNPFNLAGFLFSHKTLLR
NIGWARTLSRGRDLWSPRIYSGDYYRQGCASKLPVKWLALESLADNLYTVHSDVWAFGVT
MWEIMTRGQTPYAGIENAEIYNYLIGGNRLKQPPECMEDVYDLMYQCWSADPKQRPSFTC
LRMELENILGQLSVLSTSQDPLYINIERAEEPTAGGSLELRGRDQPYSGAGDGSDMGAVG
GTPSDYRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
Download sequence
Identical sequences ENSMMUP00000018152 9544.ENSMMUP00000018152 ENSMMUP00000018152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]