SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018193 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018193
Domain Number 1 Region: 206-410
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.05e-41
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 445-642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 855-1047
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.75e-35
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 4 Region: 651-841
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-35
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 5 Region: 1056-1237
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.93e-34
Family Laminin G-like module 0.00000108
Further Details:      
 
Domain Number 6 Region: 25-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.38e-31
Family Laminin G-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018193   Gene: ENSMMUG00000013842   Transcript: ENSMMUT00000019427
Sequence length 1539
Comment pep:known chromosome:MMUL_1:7:141422695:143072858:1 gene:ENSMMUG00000013842 transcript:ENSMMUT00000019427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLHSVFFTLKVSILLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETAVLSNKQVNDSSWHFLMVSRDRLR
TVLMLDGEGQSGELQPQRPYMDVVSDLFLGGVPADIRPSALTLDGVQAMPGFKGLILDLK
YGNSEPRLLGSQGVQLDAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGKLCSEAKCQ
VPGLSHLMMSEQAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTG
KSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDG
ILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELS
RLARIGDTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEP
NGLILFTHGKPQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDG
EWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWT
AMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNAVCKD
GWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYG
LLVATTSRDSADTLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVR
VVRRGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMF
NGLLYIDLCKNGDIDYCELKARFGLRNIIAPVTFKTKSSYSLATFQAYTSMHLFFQFKTT
SPDGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRD
NSNTHSLKVDTKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASV
DLNGRLPDLINDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSYSG
NQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGLGD
FLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVNEH
YPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRL
VGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSS
DDEDFVECEPSTDKSLSTSIFEGGYKAHAPKWESKDFRPNKVSETSRTTTTSLSPELIRF
TASSSSGMVPKLPAGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVPTA
NPTEPGIRRVPGASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDE
TRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV
Download sequence
Identical sequences ENSMMUP00000018193 ENSMMUP00000018193 9544.ENSMMUP00000018193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]